AibGenesis™ Mouse Anti-IER3 Antibody (CBMOAB-45035FYA)


Cat: CBMOAB-45035FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45035FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO45035FYA 100 µg
MO-AB-13954R Monoclonal Cattle (Bos taurus) WB, ELISA MO13954R 100 µg
MO-AB-26419H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26419C 100 µg
MO-AB-26474R Monoclonal Pig (Sus scrofa) WB, ELISA MO26474R 100 µg
MO-AB-57119W Monoclonal Marmoset WB, ELISA MO57119W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO45035FYA
SpecificityThis antibody binds to Rhesus IER3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene functions in the protection of cells from Fas- or tumor necrosis factor type alpha-induced apoptosis. Partially degraded and unspliced transcripts are found after virus infection in vitro, but these transcripts are not found in vivo and do not generate a valid protein. (From NCBI)
Product OverviewMouse Anti-Rhesus IER3 Antibody is a mouse antibody against IER3. It can be used for IER3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIER3
UniProt IDH9H5C9
Protein RefseqThe length of the protein is 151 amino acids long.
The sequence is show below: MCHSRSCHPTMTILQAPTPAPSTNPGPRRGSGPEIFTFDPLPEPAAVPAGRPSTSRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILIAEEGVPAPLPPEDAPSTASQAPTPRIPNWDFRGNLNSEHYSGDDTQCLRRD.
For Research Use Only | Not For Clinical Use.
Online Inquiry