AibGenesis™ Mouse Anti-IFI27L2 Antibody (MO-AB-13958R)


Cat: MO-AB-13958R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13958R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO13958R 100 µg
MO-AB-20570W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20570W 100 µg
MO-AB-57129W Monoclonal Marmoset WB, ELISA MO57129W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO13958R
SpecificityThis antibody binds to Cattle IFI27L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle IFI27L2 Antibody is a mouse antibody against IFI27L2. It can be used for IFI27L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterferon alpha-inducible protein 27-like protein 2; Interferon-stimulated gene 12b protein; ISG12(b); IFI27L2; FAM14A
UniProt IDQ24JY7
Protein RefseqThe length of the protein is 133 amino acids long.
The sequence is show below: MIKRAAAAAIGGALAVAAVPAVLGAVGFTGAGIAASSLAAKMMSAAAVANGGGVAAGSLVATLQSVGAAGLSTSSNILLGSIGSAFGALLGGAKRASPSPPPGGPRPEGEQPGENVPQVEPPKSPLGPEKHEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry