AibGenesis™ Mouse Anti-IFI47 Antibody (MO-AB-13962R)


Cat: MO-AB-13962R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13962R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO13962R 100 µg
MO-AB-26431H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26431C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO13962R
SpecificityThis antibody binds to Cattle IFI47.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle IFI47 Antibody is a mouse antibody against IFI47. It can be used for IFI47 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterferon gamma inducible protein 47; IFI47
UniProt IDQ3ZCI2
Protein RefseqThe length of the protein is 419 amino acids long.
The sequence is show below: MDPLLLNVIKKNDSKQLASEFLSGYKTLVSEVGGILSQVSLTRILKGFEKGQPKDVADEIQRALQSAENARQNVAVIGQSGSGKSSFINVLRGIGHEGAGSASVGVVPTTRKKTPYPHPKYPNVTFWDLPGTGTPESLPNPYQEVVGDDNYDYFIIISSSRFSSNDAFLAQKIQEKGKKFYFVRTKVDSDLYNESKSKPRSFNKETVLQQIRDNCLINLSKIVSEPTVFLVSNFKSKEFDFPKLQETLLQDLPAE.
For Research Use Only | Not For Clinical Use.
Online Inquiry