AibGenesis™ Mouse Anti-IFIT2 Antibody (MO-AB-13964R)


Cat: MO-AB-13964R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13964R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Primat-Orangutan, Rhesus (Macaca mulatta), Pig (Sus scrofa) WB, ELISA MO13964R 100 µg
MO-AB-23544W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23544W 100 µg
MO-AB-26481R Monoclonal Pig (Sus scrofa) WB, ELISA MO26481R 100 µg
MO-AB-43200W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43200W 100 µg
MO-DKB-00666W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Primat-Orangutan, Rhesus (Macaca mulatta) WB, IF 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Primat-Orangutan, Rhesus (Macaca mulatta), Pig (Sus scrofa)
CloneMO13964R
SpecificityThis antibody binds to Cattle IFIT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle IFIT2 Antibody is a mouse antibody against IFIT2. It can be used for IFIT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterferon-induced protein with tetratricopeptide repeats 2, Fragment; IFIT2
UniProt IDQ1JPG4
Protein RefseqThe length of the protein is 405 amino acids long.
The sequence is show below: MSETTKNSLEHSLQQLKSHFTWNLVEGEHSLDDFEDRVCHQTEFQNSEFKATMCNIQAFIKHCRGQHQAALECLRQAEEFIQREHADQAEVRSLVTWGNHAWVYYHLGRFADAQLYVDKVKRVCQKFSSPYRIESPELDCEEGWTRLKCGRNQNERAKVCFEKALEKNPKNPEFASGLAIASYRLDNQPPSQNPINPLRQAIQLNPDNQYVKVLLALKLQKMNKKDEGERLVEEALEKAPLATDVIRGAAKLYRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry