AibGenesis™ Mouse Anti-IFNA10 Antibody (MO-AB-07985W)


Cat: MO-AB-07985W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07985W Monoclonal Cat (Felis catus), Pig (Sus scrofa) WB, ELISA MO07985W 100 µg
MO-AB-26490R Monoclonal Pig (Sus scrofa) WB, ELISA MO26490R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Pig (Sus scrofa)
CloneMO07985W
SpecificityThis antibody binds to Cat IFNA10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses and other pathogens or tumor cells. This gene is intronless and the encoded protein is secreted. (From NCBI)
Product OverviewMouse Anti-Cat IFNA10 Antibody is a mouse antibody against IFNA10. It can be used for IFNA10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterferon alpha 10; IFNA10
UniProt IDQ863I9
Protein RefseqThe length of the protein is 189 amino acids long.
The sequence is show below: MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFAFPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRLEACVVQEVGEGEAPLTNEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYYTSTALQKRLRSEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry