AibGenesis™ Mouse Anti-IFT27 Antibody (CBMOAB-45105FYA)


Cat: CBMOAB-45105FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45105FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO45105FYA 100 µg
CBMOAB-80350FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80350FYA 100 µg
MO-AB-04450H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04450C 100 µg
MO-AB-14011R Monoclonal Cattle (Bos taurus) WB, ELISA MO14011R 100 µg
MO-AB-26086W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26086W 100 µg
MO-AB-26450H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26450C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO45105FYA
SpecificityThis antibody binds to Rhesus IFT27.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a GTP-binding protein that is a core component of the intraflagellar transport complex B. Characterization of the similar Chlamydomonas protein indicates a function in cell cycle control. Alternative splicing of this gene results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus IFT27 Antibody is a mouse antibody against IFT27. It can be used for IFT27 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIFT27
UniProt IDF6QSW6
Protein RefseqThe length of the protein is 286 amino acids long.
The sequence is show below: AGQVGYGYLESALGAVLVAGGEPGRLSLIPLGRAVLRGWAGSTDRVRSLAPFQTAVSGLEPGPPGALPCPPVPSARFSPSAQKGRAWSSPVPSRPLALEISPPTFPSQASPGPEASAAALVLWVRLAGVLVTMVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVAVPDTGDSVELFIFDSAGKELFSEMLDKLASSTPNVLCLVYDVTSEQSFNNCSKWLEKARAQAPGTSLPGTSCRHPCFPEASLSFGSRAQGHCRGSCGWRRGPGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry