AibGenesis™ Mouse Anti-IGFI Antibody (MO-AB-26569R)


Cat: MO-AB-26569R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-26569R Monoclonal Pig (Sus scrofa), Goat (Capra hircus) WB, ELISA MO26569R 100 µg
MO-AB-37484W Monoclonal Goat (Capra hircus) WB, ELISA MO37484W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Goat (Capra hircus)
CloneMO26569R
SpecificityThis antibody binds to Pig IGFI.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against IGFI. It can be used for IGFI detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInsulin-like growth factor 1 transcript variant 1; Insulin-like growth factor I; IGFI; IGF1
UniProt IDQ45QB4
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: MGKISSLPTQLFKCCFCDFLKVKMHITSSSHLFYLALCLLSFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKAQKEVHLKNTSRGSSGNKNYRM.
For Research Use Only | Not For Clinical Use.
Online Inquiry