Mouse Anti-IL1B Antibody (MO-AB-34965W)
Cat: MO-AB-34965W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-34965W | Monoclonal | Ferret (Mustela Putorius Furo), Bovine, Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Guinea pig, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Ba, Primat, Golden Syrian Hamster, Rhesus (Macaca mulatta), Human, Mouse, Rat, Zebrafish, Marmoset, O. anatinus (Ornithorhynchus anatinus), Ovis aries, Sheep, Rabbit (Oryctolagus cuniculus), Rhesus, Sheep (Ovis aries) | WB, ELISA | MO34965W | 100 µg | ||
MO-AB-08029W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08029W | 100 µg | ||
MO-AB-11896W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11896W | 100 µg | ||
MO-AB-31270W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31270W | 100 µg | ||
MO-AB-37495W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37495W | 100 µg | ||
MO-AB-41870W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41870W | 100 µg | ||
MO-AB-43204W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43204W | 100 µg | ||
MO-AB-45136W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45136W | 100 µg | ||
MO-AB-57210W | Monoclonal | Marmoset | WB, ELISA | MO57210W | 100 µg | ||
MO-AB-14122R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO14122R | 100 µg | ||
MO-AB-26707R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26707R | 100 µg | ||
MO-AB-04474H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04474C | 100 µg | ||
MO-AB-02493Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02493Y | 100 µg | ||
MO-AB-06572Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06572Y | 100 µg | ||
MO-AB-08473Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08473Y | 100 µg | ||
MO-AB-15763Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15763Y | 100 µg | ||
MO-DKB-00585W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Ba, Dog (Canis lupus familiaris), Primat, Golden Syrian Hamster, Human (Homo sapiens), Primat, Rhesus (Macaca mulatta) | WB, ELISA, EM, FC, IF, IHC, IHC-Fr, IHC-P, IP, IHC-WhMt | 100 µg | |||
MO-MMB-0060 | Polyclonal | Human, Mouse, Rat, Zebrafish | WB, IHC, IF | 100 µg | |||
MOFAB-559W | Monoclonal | Zebrafish | WB, IHC, IP | 100 µg | |||
MOFY-0622-FY25 | Monoclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0622-FY92 | Polyclonal | Ovis aries, Sheep | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0622-FY128 | Polyclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0622-FY132 | Polyclonal | Guinea pig | WB, IHC, ICC, IF | 100 µg | |||
MOFY-0622-FY162 | Polyclonal | Guinea pig | WB, IHC, ICC | 100 µg | |||
MOFY-0722-FY82 | Polyclonal | Rhesus | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY161 | Polyclonal | Dog | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY345 | Polyclonal | Bovine | WB, IHC, ICC, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Ferret (Mustela Putorius Furo), Bovine, Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Guinea pig, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Ba, Primat, Golden Syrian Hamster, Rhesus (Macaca mulatta), Human, Mouse, Rat, Zebrafish, Marmoset, O. anatinus (Ornithorhynchus anatinus), Ovis aries, Sheep, Rabbit (Oryctolagus cuniculus), Rhesus, Sheep (Ovis aries) |
Clone | MO34965W |
Specificity | This antibody binds to Ferret IL1B. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted; Lysosome; Cytosol; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. |
Product Overview | Mouse Anti-Ferret IL1B Antibody is a mouse antibody against IL1B. It can be used for IL1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Interleukin 1, beta |
UniProt ID | G9K5K2 |
Protein Refseq | The length of the protein is 270 amino acids long. The sequence is show below: MARVPEPTSEVMSYGYSDNENDLFFEADGPGKMKCCFQDLNNSYLEEEGIQLQISHQLHNKSLSHFVSVIVALEKLKKISVPCSLPLQGDDLMNVFHCIFEEEPIILEKCDDNAFVHDAPPRSLDCKFQDINQKSLVLYNSYELRALHLNGTSVNQQAVFRMTFVQEDEDITKIPVALCIKEKNLYLSCVMKDGKPTLQLEMLDPKVYPKKRMEKRFVFNKTEIKKKVEFESSQFPNWYISTSQAEAMPVFLGNNRGGHDITDFTMELSS. |
See other products for " IL1b "
MOFY-0622-FY206 | Guinea pig Anti-IL1b Antibody (MOFY-0622-FY206) |
MOFY-0722-FY74 | Mouse Anti-IL1b Antibody (MOFY-0722-FY74) |
CBMOAB-80644FYA | Mouse Anti-IL1B Antibody (CBMOAB-80644FYA) |
MOFY-0722-FY274 | Rabbit Anti-IL1b Antibody (MOFY-0722-FY274) |
For Research Use Only | Not For Clinical Use.
Online Inquiry