AibGenesis™ Mouse Anti-ilrun Antibody (CBMOAB-61200FYC)


Cat: CBMOAB-61200FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61200FYC Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO61200FYC 100 µg
MO-AB-04487H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04487C 100 µg
MO-AB-16055W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16055W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO61200FYC
SpecificityThis antibody binds to Zebrafish ilrun.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ilrun Antibody is a mouse antibody against ilrun. It can be used for ilrun detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUncharacterized protein C6orf106 homolog; ilrun
UniProt IDQ5BL31
Protein RefseqThe length of the protein is 283 amino acids long.
The sequence is show below: MEGMDIDLDQELMQKFSCMGTTDKDVLVSEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNINTPSMSFVEDVTIGEGESVPPDTPFTKTWRIQNTGTESWPPGVCLKYVGGDQFGHVNMVMVRSLDPQEISDVSVQMRSPAVPGMYQGQWRMCTATGLFYGDVIWVILSVEEGGLLGVTQQLSSFKTEFNTQPHRSLEGDYNPFASPQKNKQDTNEDHLKDPGGPWEAPLDSIQQDQNGLNHSSVNITPNGLQNNLSVVTYSQGINGPFPFGQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry