AibGenesis™ Mouse Anti-INF2 Antibody (MO-AB-03797W)


Cat: MO-AB-03797W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03797W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO03797W 100 µg
MO-AB-24959W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24959W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO03797W
SpecificityThis antibody binds to Rhesus INF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus INF2 Antibody is a mouse antibody against INF2. It can be used for INF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInverted formin-2 isoform 1; INF2
UniProt IDH9ERR9
Protein RefseqThe length of the protein is 234 amino acids long.
The sequence is show below: MSVKEGAQRKWAALKEKLGPQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLEGSDGSWMVQFLEQSGLDLLLEALARLSGRGVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHALTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRTRTQLRNEFIGLQLLDVLARLR.
For Research Use Only | Not For Clinical Use.
Online Inquiry