AibGenesis™ Mouse Anti-ing5 Antibody (MO-AB-00764R)
Cat: MO-AB-00764R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-00764R | Monoclonal | Medaka (Oryzias latipes), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) | WB, ELISA | MO00764R | 100 µg | ||
| MO-AB-02567Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02567Y | 100 µg | ||
| MO-AB-02728W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02728W | 100 µg | ||
| MO-AB-04506H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04506C | 100 µg | ||
| MO-AB-06580Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06580Y | 100 µg | ||
| MO-AB-08500Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08500Y | 100 µg | ||
| MO-AB-09694W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09694W | 100 µg | ||
| MO-AB-13952W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13952W | 100 µg | ||
| MO-AB-14191R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO14191R | 100 µg | ||
| MO-AB-26540H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26540C | 100 µg | ||
| MO-AB-31312W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31312W | 100 µg | ||
| MO-AB-34985W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34985W | 100 µg | ||
| MO-AB-45169W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45169W | 100 µg | ||
| MO-AB-57272W | Monoclonal | Marmoset | WB, ELISA | MO57272W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Medaka (Oryzias latipes), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) |
| Clone | MO00764R |
| Specificity | This antibody binds to Medaka ing5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a tumor suppressor protein that inhibits cell growth and induces apoptosis. This protein contains a PHD-type zinc finger. It interacts with tumor suppressor p53 and p300, a component of the histone acetyl transferase complex, suggesting a role in transcriptional regulation. Alternative splicing and the use of multiple promoters and 3' terminal exons results in multiple transcript variants. (From NCBI) |
| Product Overview | This product is a mouse antibody against ing5. It can be used for ing5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Inhibitor of growth protein; LOC101171565 |
| UniProt ID | H2L7U8 |
| Protein Refseq | The length of the protein is 243 amino acids long. The sequence is show below: MATAIYLEHYLDSIENLPCELQRNFTLMRDLDSRTEEKKGEIDRLAEEYISNVKNLASEQRVEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLELTGYDSTDSRTLKKGDSRGQRDKRGSRGRGKKGSDDDSPKKKKMKISQDLSDALLPMQPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLATKPKGKWFCPRCTQDRKKNKR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry