AibGenesis™ Mouse Anti-inip Antibody (CBMOAB-80887FYA)


Cat: CBMOAB-80887FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-80887FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO80887FYA 100 µg
MO-AB-03800W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03800W 100 µg
MO-AB-10818W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10818W 100 µg
MO-AB-26543H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26543C 100 µg
MO-AB-45173W Monoclonal Horse (Equus caballus) WB, ELISA MO45173W 100 µg
MO-AB-57275W Monoclonal Marmoset WB, ELISA MO57275W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO80887FYA
SpecificityThis antibody binds to Zebrafish inip.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a subunit of single-stranded DNA binding complexes that are important for maintaining genome stability. These complexes are involved in G2/M checkpoint control and homologous recombination repair. (From NCBI)
Product OverviewMouse Anti-Zebrafish inip Antibody is a mouse antibody against inip. It can be used for inip detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSOSS complex subunit C; INTS3- and NABP-interacting protein; Sensor of single-strand DNA complex subunit C; Sensor of ssDNA subunit C; SOSS-C; Single-stranded DNA-binding protein-interacting protein 1; SSB-interacting protein 1; inip; ssbip
UniProt IDQ7ZV26
Protein RefseqThe length of the protein is 103 amino acids long.
The sequence is show below: MAANPPGQGFQNKNRVAILAELDKEKRRLIQSQTLNNPGASIPLSRPAVNKEFRDQAEQQHIAAQQKAALQHAHAHSSGFFITQDSSFGNLILPVLPRLDPLE.
For Research Use Only | Not For Clinical Use.
Online Inquiry