AibGenesis™ Mouse Anti-INO80B Antibody (CBMOAB-45408FYA)


Cat: CBMOAB-45408FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45408FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO45408FYA 100 µg
CBMOAB-80895FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80895FYA 100 µg
MO-AB-04515H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04515C 100 µg
MO-AB-14196R Monoclonal Cattle (Bos taurus) WB, ELISA MO14196R 100 µg
MO-AB-24021W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24021W 100 µg
MO-AB-57278W Monoclonal Marmoset WB, ELISA MO57278W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO45408FYA
SpecificityThis antibody binds to Rhesus INO80B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of an ATP-dependent chromatin remodeling complex, INO80, which plays a role in DNA and nucleosome-activated ATPase activity and ATP-dependent nucleosome sliding. Readthrough transcription of this gene into the neighboring downstream gene, which encodes WW domain-binding protein 1, generates a non-coding transcript. (From NCBI)
Product OverviewMouse Anti-Rhesus INO80B Antibody is a mouse antibody against INO80B. It can be used for INO80B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesINO80 complex subunit B; INO80B
UniProt IDI0FVH8
Protein RefseqThe length of the protein is 356 amino acids long.
The sequence is show below: MSKLWRRASTSGAMEAPEPGEALELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGGLGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPAPALTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGAARGERRGGRAAAPAPMVRYCSGAQGSTLSFPPGVPTPTAVSQRPSPLGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMRLGGPEGPGSPLLAT.
For Research Use Only | Not For Clinical Use.
Online Inquiry