AibGenesis™ Mouse Anti-INOS Antibody (MO-AB-02569Y)
Cat: MO-AB-02569Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-02569Y | Monoclonal | Chicken (Gallus gallus), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset | WB, ELISA | MO02569Y | 100 µg | ||
| CBMOAB-21051FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO21051FYA | 100 µg | ||
| MO-AB-45174W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45174W | 100 µg | ||
| MO-AB-57281W | Monoclonal | Marmoset | WB, ELISA | MO57281W | 100 µg | ||
| MO-AB-14201R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO14201R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Chicken (Gallus gallus), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset |
| Clone | MO02569Y |
| Specificity | This antibody binds to Chicken INOS. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | This product is a mouse antibody against INOS. It can be used for INOS detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Inducible nitric oxide synthase; inos |
| UniProt ID | H9NDP8 |
| Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: GRFDVVPLIRKANGQDPEIFEYPPEIILEVPMEHPKYEWFKELDLKWYALPAVANMFLWVGGLEFTA. |
See other products for " iNOS "
For Research Use Only | Not For Clinical Use.
Online Inquiry