Mouse Anti-INOS Antibody (MO-AB-02569Y)


Cat: MO-AB-02569Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-02569Y Monoclonal Chicken (Gallus gallus), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset WB, ELISA MO02569Y 100 µg
CBMOAB-21051FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO21051FYA 100 µg
MO-AB-45174W Monoclonal Horse (Equus caballus) WB, ELISA MO45174W 100 µg
MO-AB-57281W Monoclonal Marmoset WB, ELISA MO57281W 100 µg
MO-AB-14201R Monoclonal Cattle (Bos taurus) WB, ELISA MO14201R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChicken (Gallus gallus), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset
CloneMO02569Y
SpecificityThis antibody binds to Chicken INOS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against INOS. It can be used for INOS detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesInducible nitric oxide synthase; inos
UniProt IDH9NDP8
Protein RefseqThe length of the protein is 67 amino acids long. The sequence is show below: GRFDVVPLIRKANGQDPEIFEYPPEIILEVPMEHPKYEWFKELDLKWYALPAVANMFLWVGGLEFTA.
See other products for " iNOS "
For Research Use Only | Not For Clinical Use.
Online Inquiry