AibGenesis™ Mouse Anti-ip6k1 Antibody (CBMOAB-80994FYA)


Cat: CBMOAB-80994FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-80994FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Marmoset WB, ELISA MO80994FYA 100 µg
MO-AB-04526H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04526C 100 µg
MO-AB-14235R Monoclonal Cattle (Bos taurus) WB, ELISA MO14235R 100 µg
MO-AB-14566W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14566W 100 µg
MO-AB-57330W Monoclonal Marmoset WB, ELISA MO57330W 100 µg
MO-NAB-00211W Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Rhesus (Macaca mulatta) WB, IHC, IHC-P NW0090 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Marmoset
CloneMO80994FYA
SpecificityThis antibody binds to Zebrafish ip6k1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the inositol phosphokinase family. The encoded protein may be responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Alternatively spliced transcript variants have been described. (From NCBI)
Product OverviewMouse Anti-Zebrafish ip6k1 Antibody is a mouse antibody against ip6k1. It can be used for ip6k1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesip6k1; Inositol Hexakisphosphate Kinase 1
UniProt IDF1RE97
Protein RefseqThe length of the protein is 453 amino acids long.
The sequence is show below: CTPCSPGLRARAHAPSSTWSSNAMCVPHTMEAGKHSASQGQGSCGGVPLEPFIHQVGGHTSMMRYDDHTVCKPLITREQRFYESLPPEMKEFTPEYKGVVLVCFEGDSDGYINLVAYPYEESEGLDHEELSERDQPRRKHSRRSLHRSSSEHKEDRHAHDSDGNDNLQELKSPLLDLQLHSDVPFQMLDSNSGLSSEKISHNPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCILDLKMGTRQHGDDASEEKAARQMKKCEQSTSATLGVRVCGMQVYQMDTGHYLCRNKYYGRSLSIDGFRQALFQFMHNGTLLRKDLFEPVLSKLCSLKAVLERQASYRFYSSSLLIIYEGKDPESADSWQKPSELPSAKENQATSSENPAASELHTPPQVLNVDVRMIDFAHSTFKGFRDDQTVHDGPDRGYVFGLESLINILQEIREENQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry