AibGenesis™ Mouse Anti-IQCF5 Antibody (MO-AB-14254R)


Cat: MO-AB-14254R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14254R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO14254R 100 µg
MO-AB-26554H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26554C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO14254R
SpecificityThis antibody binds to Cattle IQCF5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle IQCF5 Antibody is a mouse antibody against IQCF5. It can be used for IQCF5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIQ domain-containing protein F5; IQCF5
UniProt IDQ32KU4
Protein RefseqThe length of the protein is 149 amino acids long.
The sequence is show below: MGPKVRIMRKEENKAIVSIQAWWRGTLVRRTLLHAALRAWIIQCWWKQKLVLLMENRRRVALDAFARQEWAVVKLQSWVRMWCIRLRYLRLLHAVRIIQVYWRWHSCHTRGFIQGHYDLKENQLNLQLEISLGSQACRVQQCIPLPIKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry