AibGenesis™ Mouse Anti-isg12(a) Antibody (MO-AB-14294R)


Cat: MO-AB-14294R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14294R Monoclonal Cattle (Bos taurus), Horse (Equus caballus), Sheep (Ovis aries) WB, ELISA MO14294R 100 µg
MO-AB-15831Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15831Y 100 µg
MO-AB-45192W Monoclonal Horse (Equus caballus) WB, ELISA MO45192W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Horse (Equus caballus), Sheep (Ovis aries)
CloneMO14294R
SpecificityThis antibody binds to Cattle isg12(a).
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle isg12(a) Antibody is a mouse antibody against isg12(a). It can be used for isg12(a) detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative ISG12(A) protein; Similar to putative ISG12(A) protein; isg12(a); ISG12(A)
UniProt IDQ6IED4
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: MEFTKAVRLASNLASKILSAGSLAKVGGAASSSGLARLSPLGLTLPSSTALAGATSTLGSLVGTLKGSFLLGSPAAALSTLPVGGLTLPSSTALAGATSTLGSLVGTLKGSFLLGSPAAALSTLPVGAKAAAAVVGGASTVAAVPMVLSAVGFTSAGITASSLAAKMMSISAIANGGGVAAGSLVATLQSVGASGLCLSSKLLVGIAGSTLVSKFLGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry