AibGenesis™ Mouse Anti-Jhamt Antibody (CBMOAB-21994FYA)


Cat: CBMOAB-21994FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-21994FYA Monoclonal Fruit fly (Drosophila melanogaster), Silkworm (Bombyx mori) WB, ELISA MO21994FYA 100 µg
Inquiry
MO-AB-69996W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO69996W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Silkworm (Bombyx mori)
CloneMO21994FYA
SpecificityThis antibody binds to fruit fly Jhamt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionO-methyltransferase that transfers a methyl group from S-adenosyl-L-methionine (SAM) to the carboxyl group of juvenile hormone acids to produce active juvenile hormones in the corpora allata, the last step during juvenile hormone biosynthesis (PubMed:18549957). Also able to methylate farnesoate to methyl farnesoate (PubMed:18549957). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Jhamt Antibody is a mouse antibody against Jhamt. It can be used for Jhamt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesJuvenile hormone acid methyltransferase, isoform A; Juvenile hormone acid methyltransferase, isoform B; jhamt
UniProt IDQ9VJK8
Protein RefseqThe length of the protein is 297 amino acids long.
The sequence is show below: MNQASLYQHANQVQRHDAKLILDEFASTMQWRSDGEDALLDVGSGSGNVLMDFVKPLLPIRGQLVGTDISSQMVHYASKHYQREERTRFQVLDIGCERLPEELSGRFDHVTSFYCLHWVQNLKGALGNIYNLLKPEGGDCLLAFLASNPVYEVYKILKTNDKWSTFMQDVENFISPLHYSLSPGEEFSQLLNDVGFVQHNVEIRNEVFVYEGVRTLKDNVKAICPFLERMPADLHEQFLDDFIDIVISMNLQQGENNEDQKFLSPYKLVVAYARKTPEFVNNVFLEPTHQNLVKGIN.
For Research Use Only | Not For Clinical Use.
Online Inquiry