AibGenesis™ Mouse Anti-JMT Antibody (CBMOAB-23341FYB)


Cat: CBMOAB-23341FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23341FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO23341FYB 100 µg
CBMOAB-35394FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO35394FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO23341FYB
SpecificityThis antibody binds to Rice JMT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice JMT Antibody is a mouse antibody against JMT. It can be used for JMT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesJMT; Uncharacterized protein
UniProt IDA2ZWY8
Protein RefseqThe length of the protein is 347 amino acids long.
The sequence is show below: MAWPFLQRRGMDTLKSLITNSAADVYLSQMPERFAVADLGCSSGPNALCLAEDIIGSIGRICCRSSRPPPEFSVLLNDLPTNDFNTIFFSLPEFTDRLKAAAKSDEWGRPMVFLSGVPGSFYGRLFPAKSVHFVCSCSSLHWLSQVPSGLLDEMNRPINKGKMYISSTSPLAVPVAYLRQFQRDFSLFLKSRAAEVFSGGRMVLAMLGRQADGYIDRRTTFLWELLSESFASLVAQGLVEEDKVDAYNVPFYAPSIGEIEEEVRREGSFRMDYVQTYEINLSSSGDARRDGRTVSMAIRAIQESMLSHHFGPEIVDALFAKYTELVTASMEREEVKSVQIGVVLTRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry