AibGenesis™ Mouse Anti-KANK3 Antibody (CBMOAB-45776FYA)


Cat: CBMOAB-45776FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45776FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO45776FYA 100 µg
CBMOAB-81499FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81499FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO45776FYA
SpecificityThis antibody binds to Rhesus KANK3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KANK3 Antibody is a mouse antibody against KANK3. It can be used for KANK3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKN motif and ankyrin repeat domain-containing protein 3; KANK3
UniProt IDH9FEB1
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: QLSRPRGVARDGGAVRLVAQEWFRVSSQRRSQAEPVARMLEGVRHLGPELLAHVVNLTDGNGNTALHYSVSHGNLAIASLLLNTGVCEVNRQNRAGYSALMLAALTSVGREEEDMAVVQRLFCMGDVNAKASQTGQTALMLAISHGRQDMVASLLACGADVNAQDA.
For Research Use Only | Not For Clinical Use.
Online Inquiry