AibGenesis™ Mouse Anti-KCNJ8 Antibody (CBMOAB-45893FYA)


Cat: CBMOAB-45893FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45893FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO45893FYA 100 µg
CBMOAB-81683FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81683FYA 100 µg
MO-AB-04640H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04640C 100 µg
MO-AB-14468R Monoclonal Cattle (Bos taurus) WB, ELISA MO14468R 100 µg
MO-AB-19664W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19664W 100 µg
MO-AB-35027W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35027W 100 µg
MO-AB-41930W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41930W 100 µg
MO-AB-57632W Monoclonal Marmoset WB, ELISA MO57632W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Zebrafish (Danio rerio)
CloneMO45893FYA
SpecificityThis antibody binds to Rhesus KCNJ8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPotassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. Defects in this gene may be a cause of J-wave syndromes and sudden infant death syndrome (SIDS). (From NCBI)
Product OverviewMouse Anti-Rhesus KCNJ8 Antibody is a mouse antibody against KCNJ8. It can be used for KCNJ8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-sensitive inward rectifier potassium channel 8; KCNJ8
UniProt IDH9F918
Protein RefseqThe length of the protein is 301 amino acids long.
The sequence is show below: VRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMKTAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEVVPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDEKPSILIQTLQKSELFHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQNTSES.
For Research Use Only | Not For Clinical Use.
Online Inquiry