AibGenesis™ Mouse Anti-KCNK17 Antibody (MO-AB-14470R)


Cat: MO-AB-14470R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14470R Monoclonal Cattle (Bos taurus), Marmoset WB, ELISA MO14470R 100 µg
Inquiry
MO-AB-57638W Monoclonal Marmoset WB, ELISA MO57638W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Marmoset
CloneMO14470R
SpecificityThis antibody binds to Cattle KCNK17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. This gene is activated at alkaline pH. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Cattle KCNK17 Antibody is a mouse antibody against KCNK17. It can be used for KCNK17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPotassium channel TASK-4; KCNK17
UniProt IDQ8HZT2
Protein RefseqThe length of the protein is 341 amino acids long.
The sequence is show below: MAPDSRLSASPAKSGWRAWNASERGVQGCAVPVPSTLLLLLTYLTYLVLGTCVFWALESPAAHDSSKRFQRDKWALLRNFTCLDGQALDSLIRGIIEAYKNGDIVLGNTTSMGRWEFVGSFFFSVSTITTIGYGNLSPRTMAARLFCIFFALVGIPLNLVVLNRLGHCMQQGVHRCARRLGGAWKDPAKARWLAGSSALLSGLLLFLLLPPLLFNHMEGWTYVEGFYFSFVTLSTVGFGDYVIGMNPSRNYPLWY.
For Research Use Only | Not For Clinical Use.
Online Inquiry