AibGenesis™ Mouse Anti-KCNRG Antibody (CBMOAB-45957FYA)


Cat: CBMOAB-45957FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45957FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO45957FYA 100 µg
MO-AB-14483R Monoclonal Cattle (Bos taurus) WB, ELISA MO14483R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO45957FYA
SpecificityThis antibody binds to Rhesus KCNRG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus KCNRG Antibody is a mouse antibody against KCNRG. It can be used for KCNRG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKCNRG
UniProt IDF7GLZ7
Protein RefseqThe length of the protein is 230 amino acids long.
The sequence is show below: MSSQELVTLNVGGKIFTTRFFTIKQFPASQLACMLDGRDQEFKMVGGQIFVDRDGVLFSFILDFLRTHQLLLPTDFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFFRVFGFCSKTIEMLTGRITVFTEQPSAPTWSSNSFPPQMTLPLPPQRPSYHDLVFQCGSDSSTDNQTGVRYFLVCNGVILAHHNLRLWGSSDSPASASQIAGITGMHH.
For Research Use Only | Not For Clinical Use.
Online Inquiry