AibGenesis™ Mouse Anti-KCNS3 Antibody (CBMOAB-45959FYA)


Cat: CBMOAB-45959FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45959FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus) WB, ELISA MO45959FYA 100 µg
MO-AB-08590Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08590Y 100 µg
MO-AB-14484R Monoclonal Cattle (Bos taurus) WB, ELISA MO14484R 100 µg
MO-AB-26843R Monoclonal Pig (Sus scrofa) WB, ELISA MO26843R 100 µg
MO-AB-57675W Monoclonal Marmoset WB, ELISA MO57675W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus)
CloneMO45959FYA
SpecificityThis antibody binds to Rhesus KCNS3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KCNS3 Antibody is a mouse antibody against KCNS3. It can be used for KCNS3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPotassium voltage-gated channel subfamily S member 3; KCNS3
UniProt IDH9F7K8
Protein RefseqThe length of the protein is 284 amino acids long.
The sequence is show below: SEFQNEDGEVDDPVLEGVEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDIDVDQCSEDVPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry