AibGenesis™ Mouse Anti-KCTD11 Antibody (MO-AB-14492R)


Cat: MO-AB-14492R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14492R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO14492R 100 µg
MO-AB-19779W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19779W 100 µg
MO-AB-26627H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26627C 100 µg
MO-AB-57679W Monoclonal Marmoset WB, ELISA MO57679W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO14492R
SpecificityThis antibody binds to Cattle KCTD11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle KCTD11 Antibody is a mouse antibody against KCTD11. It can be used for KCTD11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBTB/POZ domain-containing protein KCTD11; KCTD11
UniProt IDQ58DF7
Protein RefseqThe length of the protein is 232 amino acids long.
The sequence is show below: MLGAMFRAGTPMTPNLNPEGGGHYFIDRDGKAFRHILNFLRLGRLDLPLGYGETALLRAEADFYQIRPLLDALRELEASRGTPAPTAALLHADVDSSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDPECLGALRARFGVTNEDRAEGGPHFRLEWAPRPAELPEVEYRRLGLQPLWTGAPGEPRDVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH.
For Research Use Only | Not For Clinical Use.
Online Inquiry