AibGenesis™ Mouse Anti-KCTD20 Antibody (CBMOAB-45991FYA)


Cat: CBMOAB-45991FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45991FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO45991FYA 100 µg
MO-AB-14499R Monoclonal Cattle (Bos taurus) WB, ELISA MO14499R 100 µg
MO-AB-21191W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21191W 100 µg
MO-AB-57688W Monoclonal Marmoset WB, ELISA MO57688W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO45991FYA
SpecificityThis antibody binds to Rhesus KCTD20.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KCTD20 Antibody is a mouse antibody against KCTD20. It can be used for KCTD20 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKCTD20
UniProt IDF6VHP7
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: MNVHRGSDSDRLLRQEASCLVDDTSVAAQEKEANSLASSGPHNLTYPLGPRNEGALLHELSNDGAHKQFDHYLEELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMGEEYSQILYSSKLYRFFKYIENRDVAKTVLKERGLKNIRIGIEGYPTCKEKIKRRPGGRSEVIYNYVQRPFIQMSWEKEEGKSRHVDFQCVRSKSLTNLVAAGDDVLEDHEILMHHPPQVDELDRLNAPLSQMASNDFQD.
For Research Use Only | Not For Clinical Use.
Online Inquiry