AibGenesis™ Mouse Anti-KCTD8 Antibody (CBMOAB-45997FYA)


Cat: CBMOAB-45997FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45997FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO45997FYA 100 µg
CBMOAB-81785FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81785FYA 100 µg
MO-AB-57697W Monoclonal Marmoset WB, ELISA MO57697W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO45997FYA
SpecificityThis antibody binds to Rhesus KCTD8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAuxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. Increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus KCTD8 Antibody is a mouse antibody against KCTD8. It can be used for KCTD8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKCTD8
UniProt IDF7EWZ5
Protein RefseqThe length of the protein is 473 amino acids long.
The sequence is show below: MALKDTGSGGSTILPISEMVSSSSSPGASAAAAPGPCAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTLASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLTDLVKLLSPKVIKQNSLNDEGCQSDLEDNVSQGSSDALLLRGAAAAVPSGPGVHGGGGGSGAPDKRSGFLTLGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAAFVNQYRDDKIWSSYTEYIFFRPPQKIVSPKQEHEDRKQDKVTDKGSESGTSCNELSTSSCDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWMPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry