AibGenesis™ Mouse Anti-KLC3 Antibody (CBMOAB-46446FYA)


Cat: CBMOAB-46446FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46446FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO46446FYA 100 µg
CBMOAB-82050FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82050FYA 100 µg
MO-AB-14623R Monoclonal Cattle (Bos taurus) WB, ELISA MO14623R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO46446FYA
SpecificityThis antibody binds to Rhesus KLC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the kinesin light chain gene family. Kinesins are molecular motors involved in the transport of cargo along microtubules, and are composed of two kinesin heavy chain (KHC) and two kinesin light chain (KLC) molecules. KLCs are thought to typically be involved in binding cargo and regulating kinesin activity. In the rat, a protein similar to this gene product is expressed in post-meiotic spermatids, where it associates with structural components of sperm tails and mitochondria. (From NCBI)
Product OverviewMouse Anti-Rhesus KLC3 Antibody is a mouse antibody against KLC3. It can be used for KLC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKLC3
UniProt IDF6TC19
Protein RefseqThe length of the protein is 194 amino acids long.
The sequence is show below: MSVQVVAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHRGLAGHLAEALAGQGPVTGLEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEEAVAQLEEEKRHLEFLGQLRQYDPPTETQVPRAGQGGCWALHRAPRFPRPSLESQSPNPP.
For Research Use Only | Not For Clinical Use.
Online Inquiry