AibGenesis™ Mouse Anti-KLF16 Antibody (CBMOAB-46460FYA)


Cat: CBMOAB-46460FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46460FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO46460FYA 100 µg
Inquiry
MO-AB-26655H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26655C 100 µg
Inquiry
MO-AB-26892R Monoclonal Pig (Sus scrofa) WB, ELISA MO26892R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO46460FYA
SpecificityThis antibody binds to Rhesus KLF16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription factor that binds GC and GT boxes and displaces Sp1 and Sp3 from these sequences. Modulates dopaminergic transmission in the brain. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus KLF16 Antibody is a mouse antibody against KLF16. It can be used for KLF16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKrueppel-like factor 16; KLF16
UniProt IDH9FM72
Protein RefseqThe length of the protein is 134 amino acids long.
The sequence is show below: PGAAPSAAAKSHRCPFPDCAKAYYKSSHLKSHLRTHTGERPFACDWQGCDKKFARSDELARHHRTHTGEKRFSCPLCSKRFTRSDHLAKHARRHPGFHPDLLRRPGARSTSPSDSLPCSLAGSPAPSPAPSPAP.
For Research Use Only | Not For Clinical Use.
Online Inquiry