AibGenesis™ Mouse Anti-KLF17 Antibody (CBMOAB-46461FYA)


Cat: CBMOAB-46461FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46461FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO46461FYA 100 µg
CBMOAB-82069FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82069FYA 100 µg
MO-AB-04031W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04031W 100 µg
MO-AB-04706H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04706C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO46461FYA
SpecificityThis antibody binds to Rhesus KLF17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription repressor that binds to the promoter of target genes and prevents their expression. Acts as a negative regulator of epithelial-mesenchymal transition and metastasis in breast cancer. Specifically binds the 5-CACCC-3 sequence in the promoter of ID1, a key metastasis regulator in breast cancer, and repress its expression. May be a germ cell-specific transcription factor that plays important roles in spermatid differentiation and oocyte development. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus KLF17 Antibody is a mouse antibody against KLF17. It can be used for KLF17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKLF17
UniProt IDF6UKN0
Protein RefseqThe length of the protein is 387 amino acids long.
The sequence is show below: MYNRPRAEMEQEAGELSRWQVAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPSIQHFPHSTEMLRSPLVSVEAPRQNMDEGGPQFSMPLPERGVSYCPQATLTPSQMIYCQRVSPPQQEMMIFSGPQLMPIGEPNIPRVARPFSGNLRMPPSGLPVSASTGIPMMSHARNPPMPYPGLSTVPSEETLLGPTMPSTEAQAVLPSMAQMLPPQDAHDLGMPPAEPQSLLALGSQDSLVTQPDSQEDPFLPEQPRPAPQTAEKNSRPQERTGRGGSSEARPYRCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHTRVHTRYRPYKCDQCSREFMRSDHLKQHQKTHRPGPSDPQTNSREQDGPPAAGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry