AibGenesis™ Mouse Anti-KLHDC8B Antibody (CBMOAB-46487FYA)


Cat: CBMOAB-46487FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46487FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO46487FYA 100 µg
CBMOAB-82098FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82098FYA 100 µg
MO-AB-14643R Monoclonal Cattle (Bos taurus) WB, ELISA MO14643R 100 µg
MO-AB-23166W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23166W 100 µg
MO-AB-57928W Monoclonal Marmoset WB, ELISA MO57928W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO46487FYA
SpecificityThis antibody binds to Rhesus KLHDC8B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which forms a distinct beta-propeller protein structure of kelch domains allowing for protein-protein interactions. Mutations in this gene have been associated with Hodgkin lymphoma. (From NCBI)
Product OverviewMouse Anti-Rhesus KLHDC8B Antibody is a mouse antibody against KLHDC8B. It can be used for KLHDC8B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKLHDC8B
UniProt IDF7H011
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: WTKLPRSLRMRDKRADFVVGSLGGHIVAIGGLGNQPCPLGSVESFSLARRRWEALPAMPTARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCLRDGEGLVGAVHWSSSLPEAAISMAPFAAEDTHCGSVG.
For Research Use Only | Not For Clinical Use.
Online Inquiry