AibGenesis™ Mouse Anti-KLHL3 Antibody (CBMOAB-46509FYA)


Cat: CBMOAB-46509FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46509FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO46509FYA 100 µg
CBMOAB-82135FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82135FYA 100 µg
MO-AB-14658R Monoclonal Cattle (Bos taurus) WB, ELISA MO14658R 100 µg
MO-AB-57945W Monoclonal Marmoset WB, ELISA MO57945W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO46509FYA
SpecificityThis antibody binds to Rhesus KLHL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KLHL3 Antibody is a mouse antibody against KLHL3. It can be used for KLHL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKelch-like protein 3; KLHL3
UniProt IDH9FGW4
Protein RefseqThe length of the protein is 77 amino acids long.
The sequence is show below: SRQCLSTVEQYNPATNEWTYVADMSTRRSGAGVGVLSGQLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRN.
For Research Use Only | Not For Clinical Use.
Online Inquiry