AibGenesis™ Mouse Anti-KPTN Antibody (CBMOAB-46593FYA)


Cat: CBMOAB-46593FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46593FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO46593FYA 100 µg
CBMOAB-82238FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82238FYA 100 µg
MO-AB-04740H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04740C 100 µg
MO-AB-14698R Monoclonal Cattle (Bos taurus) WB, ELISA MO14698R 100 µg
MO-AB-20541W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20541W 100 µg
MO-AB-26693H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26693C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO46593FYA
SpecificityThis antibody binds to Rhesus KPTN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a filamentous-actin-associated protein, which is involved in actin dynamics and plays an important role in neuromorphogenesis. This protein is part of the KICSTOR protein complex that localizes to lysosomes. Mutations in this gene result in an autosomal recessive form of intellectual disability. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus KPTN Antibody is a mouse antibody against KPTN. It can be used for KPTN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKPTN
UniProt IDF7GBT2
Protein RefseqThe length of the protein is 495 amino acids long.
The sequence is show below: VMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAVHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNLPGTSRRLSALGCQSGYVRVAHVDQQSREVLQMWSVLQDGPISRVIVFSLSAPKETKDKPAQDEYSVLVASMLEPAVVYRDLLHRGLEDQLLLPGSDQFDSVLCGLVTDVDLDGRPEVLVATYGQELLCYKYQGPESGLPEAQHGFRLLWQRGFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRSSGAEETSYRGRRTRQVQGQLRMQPLKHPRTHSPQTWGNSWRAHRHPLVGVVLKDRMLSSDLPRVVKLCSETPANPLLSLCLSVPI.
For Research Use Only | Not For Clinical Use.
Online Inquiry