AibGenesis™ Mouse Anti-LAC11 Antibody (CBMOAB-23372FYB)


Cat: CBMOAB-23372FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23372FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO23372FYB 100 µg
CBMOAB-35561FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO35561FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO23372FYB
SpecificityThis antibody binds to Rice LAC11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionLignin degradation and detoxification of lignin-derived products. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice LAC11 Antibody is a mouse antibody against LAC11. It can be used for LAC11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative laccase-11; EC 1.10.3.2; Benzenediol:oxygen oxidoreductase 11; Diphenol oxidase 11; Urishiol oxidase 11; LAC11; Os05g0458300 LOC_Os05g38390
UniProt IDQ0DHL5
Protein RefseqThe length of the protein is 540 amino acids long.
The sequence is show below: MATVTRLCVTKSVPTVNGQFPGPKLVVREGDTLVIRVTNNINNNVTFHWHGIRQVRSGWADGPAYITQCPIRSGGSYVYRFTVTGQRGTLWWHAHFSWLRATLYGPLVILPPRGVAYPFPKPHREVPLLLGEWFNADPEAVIKQALQTGGGPNVSDAYTFNGLPGPTYNCSSSNDTFKLRVRPGKTYLLRLINAALNDELFFGVANHTLMVVQADASYVKPFAATALVISPGQTMDVLLTAAANNPPSRSFAIAVAPYTNTVGTFDNTTAVAVLEYYGAATSAAALRSLPLPSLPAYNDTGAVANFSASFRSLASAQYPARVPRTVDRHFFFAVGLGADPCQSPVNGTCQGPNNTRFAASMNNVSFVMPRTSLLQAHYQRRYNGVLAANFPAAPRTPFNYTGTPPNNTFVTHGTRVVPLSFNTTVEVVLQDTSILGAESHPLHLHGYDFYVVGTGFGNYDASNDTAKYNLVDPVQRNTISVPTAGWVAIRFVADNPGVWIMHCHLDVHLSWGLSMAWLVNDGPLPNQKLPPPPSDIPMCS.
For Research Use Only | Not For Clinical Use.
Online Inquiry