AibGenesis™ Mouse Anti-Lark Antibody (CBMOAB-22663FYA)


Cat: CBMOAB-22663FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22663FYA Monoclonal Fruit fly (Drosophila melanogaster), Silkworm (Bombyx mori) WB, ELISA MO22663FYA 100 µg
MO-AB-70015W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70015W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Silkworm (Bombyx mori)
CloneMO22663FYA
SpecificityThis antibody binds to fruit fly Lark.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Lark Antibody is a mouse antibody against Lark. It can be used for Lark detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNA-binding protein lark; lark
UniProt IDQ94901
Protein RefseqThe length of the protein is 352 amino acids long.
The sequence is show below: MPGAGTFKLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSRMRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRSSNGMSRYGSPTPHGYEDFSRDAFDERMISSRGMRGPSPPGRRYAPY.
For Research Use Only | Not For Clinical Use.
Online Inquiry