AibGenesis™ Mouse Anti-LCN8 Antibody (CBMOAB-46813FYA)


Cat: CBMOAB-46813FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46813FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO46813FYA 100 µg
CBMOAB-60851FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60851FYC 100 µg
MO-AB-26762H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26762C 100 µg
MO-AB-26961R Monoclonal Pig (Sus scrofa) WB, ELISA MO26961R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO46813FYA
SpecificityThis antibody binds to Rhesus LCN8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LCN8 Antibody is a mouse antibody against LCN8. It can be used for LCN8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLCN8
UniProt IDF7GS46
Protein RefseqThe length of the protein is 173 amino acids long.
The sequence is show below: MSGAAEALPTATLVTGTVPLASGALTTHCIGGFWREVGVASYQSLVLMAPKRVEGLFLTLNGSNLTVKVAYNSSGSCEIERIVGSETDTTGKFAFPGHREIHVLDTDYEGYAILRVSLMWRGRNFHVLKYFTRSLEDEDRLGFWRFRELTADTGLYLAARPGRCAELLKEELI.
For Research Use Only | Not For Clinical Use.
Online Inquiry