AibGenesis™ Mouse Anti-LCR23 Antibody (CBMOAB-35673FYC)


Cat: CBMOAB-35673FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35673FYC Monoclonal A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata) WB, ELISA MO35673FC 100 µg
MO-AB-00637H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00637C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata)
CloneMO35673FC
SpecificityThis antibody binds to Arabidopsis LCR23.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis LCR23 Antibody is a mouse antibody against LCR23. It can be used for LCR23 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative defensin-like protein 158; Putative low-molecular-weight cysteine-rich protein 23; Protein LCR23; LCR23; At4g29273
UniProt IDP82737
Protein RefseqThe length of the protein is 77 amino acids long. The sequence is show below: MANISWSHFLILMLVFSVVKKGKGDQTDKYCTIIIDPRTPCDLVDCRLSCYTGYNGVGKCIASKASRTPNCVCTYNC.
For Research Use Only | Not For Clinical Use.
Online Inquiry