AibGenesis™ Mouse Anti-LCR24 Antibody (CBMOAB-35674FYC)


Cat: CBMOAB-35674FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35674FYC Monoclonal A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata) WB, ELISA MO35674FC 100 µg
MO-AB-00638H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00638C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata)
CloneMO35674FC
SpecificityThis antibody binds to Arabidopsis LCR24.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis LCR24 Antibody is a mouse antibody against LCR24. It can be used for LCR24 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDefensin-like protein 163; Low-molecular-weight cysteine-rich protein 24; Protein LCR24; LCR24; At4g29285
UniProt IDQ8LFM0
Protein RefseqThe length of the protein is 76 amino acids long. The sequence is show below: MAKLIYSYLFISMFVLSVLLALPNAEGADIKRCVVDVKLSKPCTFQECIPLCFQRYNGNGVCTGKKNEICTCAYNC.
For Research Use Only | Not For Clinical Use.
Online Inquiry