AibGenesis™ Mouse Anti-LCR53 Antibody (CBMOAB-35706FYC)


Cat: CBMOAB-35706FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35706FYC Monoclonal A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata) WB, ELISA MO35706FC 100 µg
Inquiry
MO-AB-00647H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00647C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata)
CloneMO35706FC
SpecificityThis antibody binds to Arabidopsis LCR53.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis LCR53 Antibody is a mouse antibody against LCR53. It can be used for LCR53 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative defensin-like protein 119; Putative low-molecular-weight cysteine-rich protein 53; Protein LCR53; LCR53; At3g61177
UniProt IDP82767
Protein RefseqThe length of the protein is 75 amino acids long. The sequence is show below: MAKSTIFAIFMIVFVLGMVTKETKGQEMCRDLLMRAKNCDDSTCATLCKQKWKGNGSCFPNVYRKSCLCTFPCKT.
For Research Use Only | Not For Clinical Use.
Online Inquiry