AibGenesis™ Mouse Anti-LDLRAD2 Antibody (CBMOAB-46841FYA)


Cat: CBMOAB-46841FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46841FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO46841FYA 100 µg
CBMOAB-82569FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82569FYA 100 µg
MO-AB-26769H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26769C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO46841FYA
SpecificityThis antibody binds to Rhesus LDLRAD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LDLRAD2 Antibody is a mouse antibody against LDLRAD2. It can be used for LDLRAD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLDLRAD2
UniProt IDF6VQP0
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: MEACLLQLPQRLLLLGAAALTATALETADLADLCGQTWQGDGLLLRSHAASLRFYFVAPDTDCWLWMQAAAPGDRIRFQFRFFLVYSLTPAPPALNTSPAPAGPCAPGSYLQFYEGPPGAPRPLGSALCGLTIPVPVASSGPFLGLRLVTRGRQPRVDFVGEGTSFRLGPCGAYFRCQNGRCIPSSLVCDPWGMDNCGDGSDQGSWPPADCRGPSPVPSETGSTDHHTSSSPTPSPALGSAGSLRIAAERSPPAGRDPTRQDTALEGYTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry