AibGenesis™ Mouse Anti-LECT1 Antibody (CBMOAB-46846FYA)


Cat: CBMOAB-46846FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46846FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO46846FYA 100 µg
CBMOAB-82584FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82584FYA 100 µg
MO-AB-02718Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02718Y 100 µg
MO-AB-58116W Monoclonal Marmoset WB, ELISA MO58116W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Marmoset, Zebrafish (Danio rerio)
CloneMO46846FYA
SpecificityThis antibody binds to Rhesus LECT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBifunctional growth regulator. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus LECT1 Antibody is a mouse antibody against LECT1. It can be used for LECT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLECT1
UniProt IDF7FYW5
Protein RefseqThe length of the protein is 332 amino acids long.
The sequence is show below: MTENSDKVPIALVGPDDVEFCSPPAYATVTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIEVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSELVGTNMPETTESHSGMQWRFWLTASDSPVSAFQVAGTTGTPPRINLRKFAEIQRERREVVRKIVPTTTKRPRNGPQGNPGAGRLNNETRPSIQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV.
For Research Use Only | Not For Clinical Use.
Online Inquiry