AibGenesis™ Mouse Anti-LGP2 Antibody (MO-AB-14907R)


Cat: MO-AB-14907R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14907R Monoclonal Cattle (Bos taurus), Mallard (Anas platyrhynchos) WB, ELISA MO14907R 100 µg
MO-AB-23363H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23363C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Mallard (Anas platyrhynchos)
CloneMO14907R
SpecificityThis antibody binds to Cattle LGP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle LGP2 Antibody is a mouse antibody against LGP2. It can be used for LGP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative uncharacterized protein LGP2; LGP2; DHX58
UniProt IDQ5E9G8
Protein RefseqThe length of the protein is 680 amino acids long.
The sequence is show below: MELRPYQWEVIMPALEGKNIIIWLPTGSGKTRAAAYVARRHLETVDGAKVVVLVNRVHLVTQHCEEFSRMLERRWTITTLSGDMGPRAGFGHVARRHDLLICTAELLQKALASPEEEEHVELNAFSLLVVDECHHTHKDTVYNIILSQYLELKLQRTRPLPQVLGLTASPGTGGVSTLEGAIDHVLQLCANLDTWCIMSPKDHSPQLQEHSHQPCKQYDLCHRRTQDPFGDMLKKLMDQIHDHLEMPKLRRDFGT.
For Research Use Only | Not For Clinical Use.
Online Inquiry