AibGenesis™ Mouse Anti-lhfp Antibody (CBMOAB-82681FYA)


Cat: CBMOAB-82681FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-82681FYA Monoclonal Zebrafish (Danio rerio), Marmoset WB, ELISA MO82681FYA 100 µg
MO-AB-58169W Monoclonal Marmoset WB, ELISA MO58169W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset
CloneMO82681FYA
SpecificityThis antibody binds to Zebrafish lhfp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish lhfp Antibody is a mouse antibody against lhfp. It can be used for lhfp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLipoma HMGIC fusion partner homolog; lhf
UniProt IDQ5PRC1
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: MASSLTCAGVIWALLSFLCAATSCVGFFMPYWLLGSQMGKPVSFGTFRRCSYPIRDEARGGTVMLEQCGRYASFQGIPSLEWRICTVVTGIGCGLLLLVALTAIMGCCVTDLISRTIGRVAGGIQFVGGLLIGSGCALYPLGWDSEEVRQTCSNSSDQFDLGSCEIGWAYYCTGAGAAAAMVLCTWMACFAGKKQKHYPY.
For Research Use Only | Not For Clinical Use.
Online Inquiry