AibGenesis™ Mouse Anti-lmp7 Antibody (MO-AB-15001R)


Cat: MO-AB-15001R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15001R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa) WB, ELISA MO15001R 100 µg
MO-AB-27034R Monoclonal Pig (Sus scrofa) WB, ELISA MO27034R 100 µg
MO-AB-27146W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO27146W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa)
CloneMO15001R
SpecificityThis antibody binds to Cattle lmp7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle lmp7 Antibody is a mouse antibody against lmp7. It can be used for lmp7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProteasome subunit beta type; EC 3.4.25.1, Fragment; lmp7
UniProt IDQ9TT03
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: LAFKFQHGVIVAVDSRASAGNYIATLKVNKVIEINPYLLGTMSGCAADCLYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDENGTRLSGNMFSTGSGNSHAYGVMDSGYRPDLSIEEAYDLGRRAIVHATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry