AibGenesis™ Mouse Anti-LOL1 Antibody (CBMOAB-34515FYB)


Cat: CBMOAB-34515FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34515FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO34515FYB 100 µg
Inquiry
CBMOAB-35875FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO35875FC 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO34515FYB
SpecificityThis antibody binds to Rice LOL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPutative zinc finger that may be involved in programmed cell death and defense response. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice LOL1 Antibody is a mouse antibody against LOL1. It can be used for LOL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein LOL1; Protein LSD ONE LIKE 1; OsLOL1; Putative zinc finger LOL1; LOL1; Os07g0472200
UniProt IDQ69UP7
Protein RefseqThe length of the protein is 147 amino acids long.
The sequence is show below: MVASRAPRSESPWLKKPMHGVSGSTAMASTPWSSMPPSSHSLGAQSQLVCSGCRNLLMYPAGATSICCAVCGTVTAVPAPEQKSSCNVHENKERLKGNTNGFRAPQRCARRVDGACTQVAREVHTEVALVIFTLLCVTLPGLLFSLG.
For Research Use Only | Not For Clinical Use.
Online Inquiry