AibGenesis™ Mouse Anti-lrrc3 Antibody (CBMOAB-85439FYA)


Cat: CBMOAB-85439FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-85439FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset WB, ELISA MO85439FYA 100 µg
MO-AB-15070R Monoclonal Cattle (Bos taurus) WB, ELISA MO15070R 100 µg
MO-AB-58359W Monoclonal Marmoset WB, ELISA MO58359W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset
CloneMO85439FYA
SpecificityThis antibody binds to Zebrafish lrrc3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish lrrc3 Antibody is a mouse antibody against lrrc3. It can be used for lrrc3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeucine-rich repeat-containing protein 3; lrrc3; NP_001107114.
UniProt IDA8WHP9
Protein RefseqThe length of the protein is 266 amino acids long.
The sequence is show below: MTFPAGAYVLRKVFIPHGCPLIFRLLLAVICLSVPSFACPKSCHCSERNSLTVVQCSSRNLEEIPPDLPHDTVSLQLSSNHITKIPNQAFKNLPWLQELDLSRNAIETVDAGAFKGVSESLRTLDLSHNHMQGVPKEAFARLHAKISLSNNPWHCECTLQEVLRELRLDPETVNEVSCHTSDQEKYAGKPVIQVLDSGINFCNFHHKTTDVAMFVTMFGWFTMVIAYVIYYVRHNQEDARRHLEYLKSLPSSSQISKDFDTISTVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry