AibGenesis™ Mouse Anti-LRRC3C Antibody (CBMOAB-49217FYA)


Cat: CBMOAB-49217FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49217FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO49217FYA 100 µg
MO-AB-04173W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04173W 100 µg
MO-AB-26843H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26843C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO49217FYA
SpecificityThis antibody binds to Rhesus LRRC3C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LRRC3C Antibody is a mouse antibody against LRRC3C. It can be used for LRRC3C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLRRC3C
UniProt IDF7GX45
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: PRGCYVAKEAGEQTFRCSQAGLRTVPSGIPNNTRKLYLDANQLASVPAGAFQNLPVLEELDLSHNALAHLSGAAFQGLEGTLRHLDLSANQLASVPVEAFVGLQIQVNLSANPWHCDCALQEVLQQVRLAPGTGTGIVCGPGARPDLVGQEFLLLAGEEELCGAGRGGARRSTDVALLVTMGGWLTLVVAYLVRYVWQNRDETRRSLKRAPVLPPSASCAASPLPPSP.
For Research Use Only | Not For Clinical Use.
Online Inquiry