AibGenesis™ Mouse Anti-LRRC4 Antibody (MO-AB-15075R)


Cat: MO-AB-15075R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15075R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO15075R 100 µg
MO-AB-19242W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19242W 100 µg
MO-AB-58363W Monoclonal Marmoset WB, ELISA MO58363W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO15075R
SpecificityThis antibody binds to Cattle LRRC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle LRRC4 Antibody is a mouse antibody against LRRC4. It can be used for LRRC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNetrin-G1 ligand; LRRC4
UniProt IDQ58CS0
Protein RefseqThe length of the protein is 602 amino acids long.
The sequence is show below: MKLLWQVTVHHTWNAVLLPVVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLGSLKKLWVMNSQVSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry