AibGenesis™ Mouse Anti-LRRIQ3 Antibody (CBMOAB-49267FYA)


Cat: CBMOAB-49267FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49267FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO49267FYA 100 µg
CBMOAB-85527FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO85527FYA 100 µg
MO-AB-15103R Monoclonal Cattle (Bos taurus) WB, ELISA MO15103R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO49267FYA
SpecificityThis antibody binds to Rhesus LRRIQ3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LRRIQ3 Antibody is a mouse antibody against LRRIQ3. It can be used for LRRIQ3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLRRIQ3
UniProt IDF7HTQ9
Protein RefseqThe length of the protein is 240 amino acids long.
The sequence is show below: MFHGTITEELTSHEEWSHYNENIREDQKDFVFVKFNGLHLKSMENLQSCISLRVCVVSNNFITDIHPLQSCIKLIKLDLHGNQIKSLPDNKFWSGLKNLKLLYLHDNGFAKLKNICVLSACPNLIALTMFDCPVSLKKGYRHVLVNSIWPLKALDHHVISDEEIIQNWHLPERFKACNHRLFFNFCPTLRKGTTYEEEINNIQYITSKINAILAHNSPVLIVQRWIRGFLVRKNLRYVLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry