AibGenesis™ Mouse Anti-LRRN4CL Antibody (MO-AB-15107R)


Cat: MO-AB-15107R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15107R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO15107R 100 µg
MO-AB-19838W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19838W 100 µg
MO-AB-26849H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26849C 100 µg
MO-AB-58410W Monoclonal Marmoset WB, ELISA MO58410W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO15107R
SpecificityThis antibody binds to Cattle LRRN4CL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle LRRN4CL Antibody is a mouse antibody against LRRN4CL. It can be used for LRRN4CL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLRRN4 C-terminal-like protein; LRRN4CL
UniProt IDQ3SWY4
Protein RefseqThe length of the protein is 232 amino acids long.
The sequence is show below: MPHSPCLLWLLAVTSLVPGTQPLVAGDLEGDELDETPLPAVPCDYDHCRHLQVPCQELQRAGPAACLCPGLSSALQPPHPPRLGEVRVEADMGRAEVHWCAPSSPVNQYWLLLWEGGGAPQKGPSFNSTVRRAELKGLNPGGAYVVCVVAANDAGESRAPGPGAEGLDSADGPNLGPCGRLTVPPRPLTLLHAAMGVGSALALLSCSALVWHFCLRQRWGCPRRGRPSHAGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry